99%+ Purity, Lab-Tested
COA Available
⚠️ Research Use Only
99%+ Purity, Lab-Tested
COA Available
⚠️ Research Use Only
Free Shipping Over $200
Previous
Previous Product Image

AOD-9604

Price range: $40.00 through $68.00
Next

SLU-PP-322 (250mcg, 60 Capsules)

$65.00
Next Product Image

Cagrilintide

Original price was: $80.00.Current price is: $65.00.

Cagrilintide :  ≥99% Purity (HPLC Verified) | Certificate of Analysis Included | USA Research Use Only

Cagrilintide is a synthetic long-acting acylated amylin analog. It functions as a non-selective agonist at amylin receptors (AMYRs) and the calcitonin G-protein coupled receptor (CTR). It is used in laboratory research for metabolic studies, appetite regulation, and energy balance research models

View coa

Description

Cagrilintide Peptide – Amylin Receptor Agonist for Metabolic Research

Research Overview

Cagrilintide is a synthetic long-acting acylated amylin analog. First of all, it functions as a non-selective agonist at amylin receptors (AMYRs) and the calcitonin G-protein coupled receptor (CTR)Unlike natural amylin, Cagrilintide has been engineered with a fatty acid moiety that extends its duration of action in research models.

In research settings, scientists study Cagrilintide for its involvement in appetite regulation, energy balance, and metabolic signaling pathwaysIn addition, it is being investigated as a monotherapy and in combination with other metabolic peptides for research into weight management and metabolic disorders.

When researchers buy Cagrilintide peptide, they look for proven purity, full lab reports, and quick USA shipping. Johnson Peptide delivers all three. Therefore, if you search for Cagrilintide for your lab work, you have come to the right place.


Key Research Applications

Researchers who study Cagrilintide peptide use it in several laboratory settings:

  • Amylin Receptor Studies: Scientists use Cagrilintide to investigate amylin receptor (AMYR) activation and downstream signaling pathways.

  • Calcitonin Receptor Research: Cagrilintide provides a model for studying calcitonin receptor (CTR) activation and G-protein coupled receptor signaling.

  • Appetite Regulation Studies: Researchers examine Cagrilintide’s effects on food intake, satiety pathways, and energy balance in controlled models.

  • Metabolic Pathway Mapping: Cagrilintide is used to investigate metabolic regulation, including glucose homeostasis and lipid metabolism.

  • Combination Studies: Scientists study Cagrilintide alongside GLP-1 receptor agonists for research into dual-pathway metabolic signaling.

For related research, Cagrilintide is often studied alongside other metabolic peptides such as Semaglutide for comparative analysis of metabolic signaling pathways.


Product Specifications

Specification Detail
Peptide Type Synthetic Long-Acting Acylated Amylin Analog
Sequence {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge: Cys3-Cys8)
Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight Approximately 4409.01 g/mol
CAS Number 1415456-99-3
Purity ≥99% (HPLC verified, third-party tested)
Form Lyophilized (freeze-dried) powder
Storage Store at -20°C. Protect from light and moisture.
Synonyms AM833; Long-acting acylated amylin analog

Available Strength

Strength Catalog Code Best For
5mg JP-CAGRI-5 Standard research protocols

Why Choose Cagrilintide for Research?

Feature Benefit for Your Research
Dual Receptor Agonist Targets both amylin receptors (AMYRs) and calcitonin receptors (CTR)
Long-Acting Design Fatty acid acylation extends duration in research models
Well-Characterized Published research on receptor binding and signaling pathways
≥99% Purity Reduces experimental variables for reproducible results

Quality Assurance

When you buy Cagrilintide peptide from Johnson Peptide, you get:

Quality Step What This Means for Your Work
HPLC Check Confirms ≥99% purity, so your tests have fewer unknowns
Mass Spectrometry Validates molecular weight and peptide identity
Outside Lab Test A second lab checks our work for fair results
Certificate of Analysis Full records for each batch we ship
Trackable Batch Each vial links to its own lab report

As a result, you can trust your supplies stay the same from batch to batch. This matters a lot for getting results you can repeat.

View our Certificate of Analysis library for batch-specific documentation.


How to Store, Mix, and Handle (For Lab Use)

Good handling keeps your peptide stable for your tests:

Storage (Before Mixing)

  • Keep at -20°C (freezer)

  • Shield from light (use dark vials or foil)

  • Shield from wetness (keep drying packs nearby)

How to Mix

  • Use sterile bacteriostatic water or sterile saline

  • Swirl gently—do not shake hard

  • Measure based on your test needs

Storage (After Mixing)

  • Keep cold at 2-8°C

  • Use within 14 to 30 days based on your plan

  • Do not freeze and thaw more than once (split into small doses first)

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide”

Your email address will not be published. Required fields are marked *

Shopping cart

0
image/svg+xml

No products in the cart.

Continue Shopping